PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.126220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 338aa    MW: 37923.3 Da    PI: 5.9703
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.126220.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.1e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d++++ G g+W+t ++  g+ R++k+c++rw +yl
   Cucsa.126220.1 14 KGPWTPEEDQKLIDYIQKNGHGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.45.9e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia +++ gRt++++k++w+++
   Cucsa.126220.1  67 RGRFSFEEEETIIQLHSVLGNK-WSAIATRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-26564IPR009057Homeodomain-like
PROSITE profilePS5129425.36965IPR017930Myb domain
SuperFamilySSF466891.8E-3111108IPR009057Homeodomain-like
SMARTSM007172.1E-141363IPR001005SANT/Myb domain
PfamPF002498.0E-171461IPR001005SANT/Myb domain
CDDcd001672.08E-121661No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2665116IPR009057Homeodomain-like
SMARTSM007177.4E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129420.44466116IPR017930Myb domain
PfamPF002492.8E-1567111IPR001005SANT/Myb domain
CDDcd001679.26E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRTPCCDKN GLKKGPWTPE EDQKLIDYIQ KNGHGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSVLGNKWS AIATRLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDLSSILR STLYNSSQMN LSSLLGVQPL VNPELLKLAA SLMSSERKNP  180
SFSPQNSSHT TTATIQFSNP QLQMQVPMQE IVQFPSQVVE PNIASELNDD QWGNGQLNNF  240
DLATGSFEYC GLDQQQQAGA IAVDNSYETA TFNFHNGNGN GNNFSLGSVL SSPCSSSPTQ  300
MNSNSTYFTS PTEDERESYC SQILNFEISD IFDEPFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004146632.10.0PREDICTED: protein ODORANT1-like
TrEMBLA0A0A0LXA40.0A0A0A0LXA4_CUCSA; Uncharacterized protein
STRINGVIT_00s0203g00070.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-96MYB-like 102